C Reactive Protein (CRP)
C-RP; PTX1; Pentraxin-Related; Pentraxin 1
Catalog No. rP90821Hu01 Organism Homo sapiens (Human)
Applications SDS-PAGE; WB; ELISA; IP.
Certification
Manufacturer Uscn Life Science Inc.
Origin  USA   WUHAN (Export Processing Zone)
Source Prokaryotic expression
Host E.coli
Molecular Mass 27.1kDa Purity > 95%
U O M 10ug / 50ug / 100ug
Price $105 / $210 / $315
Guestbook   (email@yahoo.com)   Download Manual    MSDS
rProteins Antibodies
CLIA Kits ELISA Kits
Residues: Phe17~Pro224 (Accession # P02741), with two N-terminal Tags, His-tag and T7-tag. Grade & Purity: >95%, 28 kDa as determined by SDS-PAGE reducing conditions. The target protein is fused with two N-terminal Tags, His-tag and T7-tag, its sequence is listed below. MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-FGQT DMSRKAFVFP KESDTSYVSL KAPLTKPLKA FTVCLHFYTE LSSTRGYSIF SYATKRQDNE ILIFWSKDIG YSFTVGGSEI LFEVPEVTVA PVHICTSWES ASGIVEFWVD GKPRVRKSLK KGYTVGAEAS IILGQEQDSF GGNFEGSQSL VGDIGNVNMW DFVLSPDEIN TIYLGGPFSP NVLNWRALKY EVQGEVFTKP QLWP