Polyclonal Antibody to Thrombin Activatable Fibrinolysis Inhibitor (TAFI)
CPB2; CPU; PCPB; Carboxypeptidase B2; Plasma Carboxypeptidase B2; Carboxypeptidase U
Catalog No. pA90615Mu01 Organism Mus musculus (Mouse)
Applications WB, ICC, IHC-P, IHC-F, ELISA
Certification
Manufacturer Uscn Life Science Inc.
Origin  USA   WUHAN (Export Processing Zone)
Clonality Polyclonal Host Rabbit
Conjugate No Conjugate
Concentration 200ug/ml
U O M 50ug / 100ug
Price $226 / $324     Free Shipping
Guestbook   (email@yahoo.com)    Download Manual    MSDS
rProteins Antibodies
CLIA Kits ELISA Kits
Immunogen: Recombinant mouse TAFI (His309~Asp374) expressed in E.coli. Molecular Weight: 13.2 kDa USCN accession No.: P90615Mu01 Sequence: The target protein is fused with two N-terminal Tags, His-tag and S-tag and its sequence is listed below. MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-HS YSQQILFPYS YNRSKSKDHE ELSLVASEAV RAIESINKNT RYTHGSGSES LYLAPGGSDD WIYD